Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Cynomolgus (HEK293, His)

CD200R1 Protein is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells. CD200R1 Protein can also be induced in certain T-cell subsets. CD200R1 signaling inhibits the expression of proinflammatory molecules[1]. CD200R1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD200R1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

SNSLCMDEKQITQNHSKVLAEVNISWPVQMARNAVLCCPPIEFRNLIVITWEIILRGQPSCTKTYRKDTNETKETNCTDERITWVSTPDQNSDLQIHPVAITHDGYYRCIMATPDGNFHRGYHLQVLVTPEVTLFESRNRTAVCKAVAGKPAAQISWIPAGDCAPTEQEYWGNGTVTVKSTCHWEGHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKL

Molecular Formula

102139962 (Gene_ID) XP_005548207.1 (S47-L267) (Accession)

Molecular Weight

Approximately 43-75 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf112 (NOL4L) Human Gene Knockout Kit (CRISPR)
KN420718 1 Kit

C20orf112 (NOL4L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant c-Myc Antibody
RC-16971-01 50 μL

Recombinant c-Myc Antibody

Sign In for Pricing
View Details
Recombinant c-Myc Antibody
RC-16971-02 100 µL

Recombinant c-Myc Antibody

Sign In for Pricing
View Details
Recombinant c-Myc Antibody
RC-16971-03 1 mL

Recombinant c-Myc Antibody

Sign In for Pricing
View Details
Histone H1.0 Recombinant Rabbit Monoclonal Antibody [SD206-04]
ET1612-24 100 µL

Histone H1.0 Recombinant Rabbit Monoclonal Antibody [SD206-04]

Sign In for Pricing
View Details
NUR77 (NR4A1) Rabbit Polyclonal Antibody
TA379301 100 µL

NUR77 (NR4A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details