Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Laminin subunit gamma-2 (LAMC2), partial

Product Specifications

Product Name Alternative

Cell-scattering factor 140 kDa subunit; CSF 140 kDa subunit; Epiligrin subunit gamma; Kalinin subunit gamma; Kalinin/nicein/epiligrin 100 kDa subunit; Ladsin 140 kDa subunit; Laminin B2t chain; Laminin-5 subunit gamma; Large adhesive scatter factor 140 kDa subunit; Nicein subunit gamma

Abbreviation

Recombinant Human LAMC2 protein, partial

Gene Name

LAMC2

UniProt

Q13753

Expression Region

417-588aa

Organism

Homo sapiens (Human)

Target Sequence

NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ladsin exerts cell-scattering activity toward a wide variety of cells, including epithelial, endothelial, and fibroblastic cells.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-5-chlorosulfonylbenzoic Acid
TRC-C365057-500MG 500 mg

2-Chloro-5-chlorosulfonylbenzoic Acid

Sign In for Pricing
View Details
STAMBP Antibody
KC-7169-01 50 μL

STAMBP Antibody

Sign In for Pricing
View Details
STAMBP Antibody
KC-7169-02 100 µL

STAMBP Antibody

Sign In for Pricing
View Details
STAMBP Antibody
KC-7169-03 1 mL

STAMBP Antibody

Sign In for Pricing
View Details
Recombinant Mouse SIRPA/CD172a Protein (Fc Tag)
PKSM041145-01 10 µg

Recombinant Mouse SIRPA/CD172a Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse SIRPA/CD172a Protein (Fc Tag)
PKSM041145-02 50 µg

Recombinant Mouse SIRPA/CD172a Protein (Fc Tag)

Sign In for Pricing
View Details