Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated

Product Specifications

Product Name Alternative

Basic fibroblast growth factor; bFGFHeparin-binding growth factor 2; HBGF-2

Abbreviation

Recombinant Human FGF2 protein, Biotinylated

Gene Name

FGF2

UniProt

P09038

Expression Region

143-288aa

Organism

Homo sapiens (Human)

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

64.2 kDa

References & Citations

"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 Ras (HRAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]
TA505665BM 100 µL

p21 Ras (HRAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF647 conjugate, 0.1mg/mL
BNC471604-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCSK9 Mouse monoclonal Antibody [2F1]
EM1701-26-50UL 50 µL

PCSK9 Mouse monoclonal Antibody [2F1]

Sign In for Pricing
View Details
Human FSH (Follicle Stimulating Hormone) ELISA Kit
E-EL-H1143-01 24 Tests

Human FSH (Follicle Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
Human FSH (Follicle Stimulating Hormone) ELISA Kit
E-EL-H1143-02 48 Tests

Human FSH (Follicle Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
Human FSH (Follicle Stimulating Hormone) ELISA Kit
E-EL-H1143-03 96 Tests

Human FSH (Follicle Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details