Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated

Product Specifications

Product Name Alternative

Basic fibroblast growth factor; bFGFHeparin-binding growth factor 2; HBGF-2

Abbreviation

Recombinant Human FGF2 protein, Biotinylated

Gene Name

FGF2

UniProt

P09038

Expression Region

143-288aa

Organism

Homo sapiens (Human)

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

64.2 kDa

References & Citations

"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crude Agaricus bisporus Lectin (Mushroom) -ABA-
L-5000-100 100 mg

Crude Agaricus bisporus Lectin (Mushroom) -ABA-

Sign In for Pricing
View Details
Human ZNF418 activation kit by CRISPRa
GA115620 1 Kit

Human ZNF418 activation kit by CRISPRa

Sign In for Pricing
View Details
NAT1 (NM_001160171) Human Over-expression Lysate
LC431837 20 µg

NAT1 (NM_001160171) Human Over-expression Lysate

Sign In for Pricing
View Details
E2F2 Recombinant Rabbit Monoclonal Antibody [SN201-04]
ET1611-88 100 µL

E2F2 Recombinant Rabbit Monoclonal Antibody [SN201-04]

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS620962 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Strychnine Nitrate
TRC-S687235-250MG 250 mg

Strychnine Nitrate

Sign In for Pricing
View Details