IL-20, Human
IL-20 Protein, Human is a member of the IL-10 family of cytokines. Interleukin-20 binds to the IL-20 heterodimeric receptor with a Kd of 1.5 nM.
Product Specifications
Product Name Alternative
IL-20 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Applications
COVID-19-immunoregulation
Assay Protocol
https://www.medchemexpress.com/cytokines/il-20-protein-human.html
Purity
95.00
Smiles
MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Molecular Formula
50604 (Gene_ID) Q9NYY1-1 (L25-E176) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;104 (1) :9-19.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2559141-01 20 Tests
Anti-Human CD184 Monoclonal Antibody (APC Conjugated)
Sign In for Pricing
View Details MBS2559141-02 100 Tests
Anti-Human CD184 Monoclonal Antibody (APC Conjugated)
Sign In for Pricing
View Details MBS2559141-03 2x 100 Tests
Anti-Human CD184 Monoclonal Antibody (APC Conjugated)
Sign In for Pricing
View Details MBS2559141-04 10x 100 Tests
Anti-Human CD184 Monoclonal Antibody (APC Conjugated)
Sign In for Pricing
View Details MBS1413208-01 0.02 mg (E-Coli)
Recombinant Pyrococcus abyssi Trk system potassium uptake protein trkA homolog (trkA)
Sign In for Pricing
View Details MBS1413208-02 0.1 mg (E-Coli)
Recombinant Pyrococcus abyssi Trk system potassium uptake protein trkA homolog (trkA)
Sign In for Pricing
View Details