Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-20, Human

IL-20 Protein, Human is a member of the IL-10 family of cytokines. Interleukin-20 binds to the IL-20 heterodimeric receptor with a Kd of 1.5 nM.

Product Specifications

Product Name Alternative

IL-20 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-20-protein-human.html

Purity

95.00

Smiles

MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Molecular Formula

50604 (Gene_ID) Q9NYY1-1 (L25-E176) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;104 (1) :9-19.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pank1 3'UTR GFP Stable Cell Line
TU165878 1.0 mL

Pank1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
STAG2 sgRNA CRISPR Lentivector set (Human)
K2298201 3x 1.0 µg

STAG2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
KCNN4 (NM_002250) Human Untagged Clone
SC121952 10 µg

KCNN4 (NM_002250) Human Untagged Clone

Sign In for Pricing
View Details
Farnesyl Diphosphate Farnesyltransferase 1 (FDFT1) Polyclonal Antibody
CAU25455-01 100 µL

Farnesyl Diphosphate Farnesyltransferase 1 (FDFT1) Polyclonal Antibody

Sign In for Pricing
View Details
Farnesyl Diphosphate Farnesyltransferase 1 (FDFT1) Polyclonal Antibody
CAU25455-02 200 µL

Farnesyl Diphosphate Farnesyltransferase 1 (FDFT1) Polyclonal Antibody

Sign In for Pricing
View Details
Farnesyl Diphosphate Farnesyltransferase 1 (FDFT1) Polyclonal Antibody
CAU25455-03 1 mL

Farnesyl Diphosphate Farnesyltransferase 1 (FDFT1) Polyclonal Antibody

Sign In for Pricing
View Details