Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1D, Human (His-SUMO)

The CD1D protein, a key antigen-presenting molecule, binds self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells. Partnering with B2M, it centrally orchestrates immune responses, and its interactions with MHC II emphasize its significance in the intricate network of immune system regulation. CD1D Protein, Human (His-SUMO) is the recombinant human-derived CD1D, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of CD1D Protein, Human (His-SUMO) is 282 a.a..

Product Specifications

Product Name Alternative

CD1D Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/cd1d-protein-human-his-sumo.html

Smiles

EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS

Molecular Formula

912 (Gene_ID) P15813 (E20-S301) (Accession)

Molecular Weight

Approximately 47.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Cys (StBu) Wang Resin
H0370751309.5G 5 g

Fmoc-Cys (StBu) Wang Resin

Sign In for Pricing
View Details
AMELX (NM_001142) Human Over-expression Lysate
LC420105 20 µg

AMELX (NM_001142) Human Over-expression Lysate

Sign In for Pricing
View Details
RAD21L1 Human Gene Knockout Kit (CRISPR)
KN426843 1 Kit

RAD21L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), 0.2mg/mL
BNUB1135-100 1x 100 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), 0.2mg/mL

Sign In for Pricing
View Details
Decorin (DCN) (NM_133503) Human Over-expression Lysate
LY403339 100 µg

Decorin (DCN) (NM_133503) Human Over-expression Lysate

Sign In for Pricing
View Details
ID3 (NM_002167) Human Over-expression Lysate
LC419492 20 µg

ID3 (NM_002167) Human Over-expression Lysate

Sign In for Pricing
View Details