Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella longbeachae Outer membrane protein MIP (mip)

Product Specifications

Product Name Alternative

Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Rotamase

Abbreviation

Recombinant Legionella longbeachae mip protein

Gene Name

Mip

UniProt

P53605

Expression Region

21-233aa

Organism

Legionella longbeachae

Target Sequence

ATDATSLTTDKDKLSYSIGADLGKNFKNQGIDINPDVLAKGMQDGMSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGDAFLSANKSKPGIVVLPSGLQYKIIDAGTGAKPGKSDTVTVEYTGTLIDGTVFDSTEKAGKPATFQVSQVIPGWTEALQLMPAGSTWEVFVPADLAYGPRSVGGPIGPNETLIFKIHLISVKKAA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS26P56 AAV siRNA Pooled Vector
42345161 1.0 µg

RPS26P56 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human CRMP4 Protein - (Dry Ice)
H00001809-P01-25ug 25 µg

Recombinant Human CRMP4 Protein - (Dry Ice)

Sign In for Pricing
View Details
Mouse mmu-miR-6962-5p miRNA Antagomir
abx889225-01 10 nmol

Mouse mmu-miR-6962-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-6962-5p miRNA Antagomir
abx889225-02 20 nmol

Mouse mmu-miR-6962-5p miRNA Antagomir

Sign In for Pricing
View Details
ING5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1088105 3x 1.0 µg

ING5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human UCP3 activation kit by CRISPRa
GA105064 1 Kit

Human UCP3 activation kit by CRISPRa

Sign In for Pricing
View Details