Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHH, Human

The DHH protein is cleaved into N- and C-product fragments through autoproteolysis and cholesterol transferase activity, where the N-product acquires the cholesterol moiety. In the endoplasmic reticulum, DHH is critical for juxtocrine signaling, endothelial integrity, and Schwann cell-mediated nerve sheath development. DHH Protein, Human (Tag Free) is the recombinant human-derived DHH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

DHH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dhh-protein-human-tag-free.html

Purity

95.00

Smiles

GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG

Molecular Formula

50846 (Gene_ID) O43323 (G24-G198) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A8 Polyclonal Antibody
MBS9237516-01 0.1 mL

SLC26A8 Polyclonal Antibody

Sign In for Pricing
View Details
SLC26A8 Polyclonal Antibody
MBS9237516-02 5x 0.1 mL

SLC26A8 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Cynomolgus TSLP (C-6His)
EPT093 10 µg

Recombinant Cynomolgus TSLP (C-6His)

Sign In for Pricing
View Details
Ccdc148 sgRNA CRISPR Lentivector set (Rat)
K6523801 3x 1.0 µg

Ccdc148 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
EphA2 (N-term) Rabbit Polyclonal Antibody
E10G33578 100 µL

EphA2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CETP Antibody Picoband® Fluoro550 Conjugated
A00309-1-Fluoro550 100 µg/Vial

Anti-CETP Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details