Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM-1, Human (HEK293, His)

The TREM-1 protein is a cell surface receptor that critically regulates innate and adaptive immunity by enhancing inflammatory responses. TREM-1 plays a crucial role in acute and chronic inflammatory diseases, acting as a decoy receptor to balance its pro-inflammatory effects. TREM-1 Protein, Human (HEK293, His) is the recombinant human-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TREM-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trem-1-protein-human-hek-293-his.html

Purity

98.0

Smiles

ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR

Molecular Formula

54210 (Gene_ID) Q9NP99-1 (A21-R200) (Accession)

Molecular Weight

26-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), CF594 conjugate, 0.1mg/mL
BNC940788-500 1x 500 µL

MART-1 / Melan-A (MLANA/788), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF740 conjugate, 0.1mg/mL
BNC740046-100 1x 100 µL

Pgp9.5 (UCHL-1) (31A3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details