Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3R alpha/CD123, Cynomolgus (HEK293, His)

IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation. IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3r-alpha-cd123-protein-cynomolgus-hek293-his.html

Purity

97.55

Smiles

RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSR

Molecular Formula

102138639 (Gene_ID) G8F3K3 (R18-R302) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Eosinophil Chemotactic Factor (ECF) ELISA Kit
EKN45027 96 Tests

Rat Eosinophil Chemotactic Factor (ECF) ELISA Kit

Sign In for Pricing
View Details
Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit
MBS7222383-01 48 Well

Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit

Sign In for Pricing
View Details
Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit
MBS7222383-02 96 Well

Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit

Sign In for Pricing
View Details
Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit
MBS7222383-03 5x 96 Well

Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit

Sign In for Pricing
View Details
Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit
MBS7222383-04 10x 96 Well

Mouse 26S protease regulatory subunit 7 (PSMC2) ELISA Kit

Sign In for Pricing
View Details
RAB22A ORF Vector (Human) (pORF)
ORF008481 1.0 µg DNA

RAB22A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details