Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA5, Human (HEK293, His)

PDIA5 Protein catalyzes the rearrangement of disulfide bonds in proteins, ensuring proper folding and stabilization. Its vital role maintains protein structure and function, guaranteeing effective performance of designated biological tasks through correct disulfide bond formation. PDIA5 Protein, Human (HEK293, His) is the recombinant human-derived PDIA5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDIA5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdia5-protein-human-hek-293-his.html

Purity

93.00

Smiles

SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL

Molecular Formula

10954 (Gene_ID) Q14554-2 (S22-L262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
CTRB1 (NM_001906) Human Over-expression Lysate
LY419664 100 µg

CTRB1 (NM_001906) Human Over-expression Lysate

Sign In for Pricing
View Details
Hemoglobin subunit gamma 1and2 Recombinant Rabbit Monoclonal Antibody [JM84-10]
ET1703-46 100 µL

Hemoglobin subunit gamma 1and2 Recombinant Rabbit Monoclonal Antibody [JM84-10]

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10E12]
TA808187AM 100 µL

POTEG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10E12]

Sign In for Pricing
View Details
NAD+/NADH Colorimetric Assay Kit (WST-8)
E-BC-K804-M 96 T (80 samples)

NAD+/NADH Colorimetric Assay Kit (WST-8)

Sign In for Pricing
View Details