Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA5, Human (HEK293, His)

PDIA5 Protein catalyzes the rearrangement of disulfide bonds in proteins, ensuring proper folding and stabilization. Its vital role maintains protein structure and function, guaranteeing effective performance of designated biological tasks through correct disulfide bond formation. PDIA5 Protein, Human (HEK293, His) is the recombinant human-derived PDIA5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDIA5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdia5-protein-human-hek-293-his.html

Purity

93.00

Smiles

SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL

Molecular Formula

10954 (Gene_ID) Q14554-2 (S22-L262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS708873 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
CD51 / Integrin V (ITGAV/1610), Biotin conjugate, 0.1mg/mL
BNCB1610-100 1x 100 µL

CD51 / Integrin V (ITGAV/1610), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pin1 Recombinant Rabbit monoclonal Antibody
HA751373 100 µL

Pin1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CAMKIV Antibody
KC-6104-01 50 μL

CAMKIV Antibody

Sign In for Pricing
View Details
CAMKIV Antibody
KC-6104-02 100 µL

CAMKIV Antibody

Sign In for Pricing
View Details
CAMKIV Antibody
KC-6104-03 1 mL

CAMKIV Antibody

Sign In for Pricing
View Details