Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA5, Human (HEK293, His)

PDIA5 Protein catalyzes the rearrangement of disulfide bonds in proteins, ensuring proper folding and stabilization. Its vital role maintains protein structure and function, guaranteeing effective performance of designated biological tasks through correct disulfide bond formation. PDIA5 Protein, Human (HEK293, His) is the recombinant human-derived PDIA5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDIA5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdia5-protein-human-hek-293-his.html

Purity

93.00

Smiles

SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL

Molecular Formula

10954 (Gene_ID) Q14554-2 (S22-L262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2581805 3x 1.0 µg

UCP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Trehalase (TREH) Magnetic Fluorescence Assay Kit
MBS2160621-01 96 Tests

Trehalase (TREH) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Trehalase (TREH) Magnetic Fluorescence Assay Kit
MBS2160621-02 5x 96 Tests

Trehalase (TREH) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Trehalase (TREH) Magnetic Fluorescence Assay Kit
MBS2160621-03 10x 96 Tests

Trehalase (TREH) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Mouse Muscarinic Acetylcholine Receptor M2 (CHRM2) ELISA Kit
abx255265-01 96 Tests

Mouse Muscarinic Acetylcholine Receptor M2 (CHRM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Muscarinic Acetylcholine Receptor M2 (CHRM2) ELISA Kit
abx255265-02 5x 96 Tests

Mouse Muscarinic Acetylcholine Receptor M2 (CHRM2) ELISA Kit

Sign In for Pricing
View Details