Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3, Human (98a.a, His)

Histone H3 proteins are critical in nucleosomes, which compact DNA into chromatin and regulate DNA accessibility. Histone H3 Protein, Human (98a.a, His) is the recombinant human-derived Histone H3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Histone H3 Protein, Human (98a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-h3-1-protein-human.html

Purity

98.00

Smiles

PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Molecular Formula

8350 (Gene_ID) P68431 (P39-A136) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tripartite Motif-Containing Protein 72 (TRIM72) Antibody
abx431946 200 µL

Tripartite Motif-Containing Protein 72 (TRIM72) Antibody

Ask
View Details
PORIM rabbit pAb
ES11121-01 50 µL

PORIM rabbit pAb

Ask
View Details
PORIM rabbit pAb
ES11121-02 100 µL

PORIM rabbit pAb

Ask
View Details
CBL-C, NT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (MaxLight 490)
MBS6466267-01 0.1 mL

CBL-C, NT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (MaxLight 490)

Ask
View Details
CBL-C, NT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (MaxLight 490)
MBS6466267-02 5x 0.1 mL

CBL-C, NT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (MaxLight 490)

Ask
View Details
Rabbit Polyclonal Laminin beta 1 Antibody [Alexa Fluor 700]
NB120-6571AF700 0.1 mL

Rabbit Polyclonal Laminin beta 1 Antibody [Alexa Fluor 700]

Ask
View Details