Histone H3, Human (98a.a, His)
Histone H3 proteins are critical in nucleosomes, which compact DNA into chromatin and regulate DNA accessibility. Histone H3 Protein, Human (98a.a, His) is the recombinant human-derived Histone H3 protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Histone H3 Protein, Human (98a.a, His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/histone-h3-1-protein-human.html
Purity
98.00
Smiles
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular Formula
8350 (Gene_ID) P68431 (P39-A136) (Accession)
Molecular Weight
Approximately 13 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (MaxLight 490)
PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (MaxLight 490)
Rabbit anti-human dihydropyrimidinase-like 2 polyclonal Antibody
Rabbit anti-human dihydropyrimidinase-like 2 polyclonal Antibody