Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3, Human (98a.a, His)

Histone H3 proteins are critical in nucleosomes, which compact DNA into chromatin and regulate DNA accessibility. Histone H3 Protein, Human (98a.a, His) is the recombinant human-derived Histone H3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Histone H3 Protein, Human (98a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-h3-1-protein-human.html

Purity

98.00

Smiles

PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Molecular Formula

8350 (Gene_ID) P68431 (P39-A136) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C21orf59 (Uncharacterized Protein C21orf59, C21orf48, FLJ20467, FLJ37137, FLJ40247)
124122 50 µg

C21orf59 (Uncharacterized Protein C21orf59, C21orf48, FLJ20467, FLJ37137, FLJ40247)

Ask
View Details
RBMS1 Mouse Monoclonal Antibody [Clone ID: LBI2H1]
AMM18465V 100 µL

RBMS1 Mouse Monoclonal Antibody [Clone ID: LBI2H1]

Ask
View Details
CYBA, CT (CYBA, Cytochrome b-245 light chain, Cytochrome b (558) alpha chain, Cytochrome b558 subunit alpha, Neutrophil cytochrome b 22kD polypeptide, Superoxide-generating NADPH oxidase light chain subunit, p22 phagocyte B-cytochrome, p22-phox) (Biotin)
034409-Biotin 200 µL

CYBA, CT (CYBA, Cytochrome b-245 light chain, Cytochrome b (558) alpha chain, Cytochrome b558 subunit alpha, Neutrophil cytochrome b 22kD polypeptide, Superoxide-generating NADPH oxidase light chain subunit, p22 phagocyte B-cytochrome, p22-phox) (Biotin)

Ask
View Details