Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sap130, Mouse (His)

Sap130 Protein, a transcriptional repressor, participates in mSin3A corepressor complex assembly or enzymatic activity. It's a component of the complex, including SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1, and HDAC2. Sap130 also interacts with CLEC4E, especially when released by dead or dying cells. Sap130 Protein, Mouse (His) is the recombinant mouse-derived Sap130 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Sap130 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sap130-protein-mouse-his.html

Purity

97

Smiles

PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

Molecular Formula

269003 (Gene_ID) Q8BIH0-1 (P845-V1057) (Accession)

Molecular Weight

Approximately 34 kDa.The reducing (R) protein migrat es as 34 kDa in SDS-PAGE may be due to molecular structure of protein.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NECAB1 siRNA (Rat)
CRR1822-01 15 nmol

NECAB1 siRNA (Rat)

Sign In for Pricing
View Details
NECAB1 siRNA (Rat)
CRR1822-02 30 nmol

NECAB1 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)
ARP8098-01 10 µg

Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)
ARP8098-02 50 µg

Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)
ARP8098-03 100 µg

Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)
ARP8098-04 1 mg

Recombinant Mouse TNFRSF19 / TROY Protein (His & Fc tag)

Sign In for Pricing
View Details