Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPRSS11GP Protein Lysate (Human) with C-Ha Tag
47144031 100 µg

TMPRSS11GP Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PLA2G4C Blocking Peptide
MBS9624155-01 1 mg

PLA2G4C Blocking Peptide

Sign In for Pricing
View Details
PLA2G4C Blocking Peptide
MBS9624155-02 5x 1 mg

PLA2G4C Blocking Peptide

Sign In for Pricing
View Details
Recombinant Mouse DEFB2 Protein, His (Fc)-Avi-tagged
DEFB2-2304M 50 µg

Recombinant Mouse DEFB2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Ifng (Interferon gamma, IFN-gamma, Ifg) (PE) discontinued
138033-PE 100 µL

Ifng (Interferon gamma, IFN-gamma, Ifg) (PE) discontinued

Sign In for Pricing
View Details
LRRC8D Antibody
A27745-100UL 100 µL

LRRC8D Antibody

Sign In for Pricing
View Details