Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Soluble Cluster of differentiation 21,sCD21 ELISA Kit
CN-03737H2 48T

Human Soluble Cluster of differentiation 21,sCD21 ELISA Kit

Sign In for Pricing
View Details
Thyn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4954203 1.0 µg DNA

Thyn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
LYSMD1 Antibody, FITC conjugated
A62770-100UG 100 µg

LYSMD1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Kallikrein 5 (KLK5) Rabbit Monoclonal Antibody
TA424223 100 µL

Kallikrein 5 (KLK5) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HPK1-IN-17
MF-0138236-01 25 mg

HPK1-IN-17

Sign In for Pricing
View Details
HPK1-IN-17
MF-0138236-02 50 mg

HPK1-IN-17

Sign In for Pricing
View Details