Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BNIP3L (BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like) QuickTest ELISA Kit
QT-EH6731 96 Tests

Human BNIP3L (BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like) QuickTest ELISA Kit

Sign In for Pricing
View Details
TNXB Protein Vector (Human) (pPB-N-His)
PV043358 500 ng

TNXB Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (PE)
125499-PE 100 µL

CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (PE)

Sign In for Pricing
View Details
ITGB8 (Integrin beta-8) (MaxLight 550)
128649-ML550 100 µL

ITGB8 (Integrin beta-8) (MaxLight 550)

Sign In for Pricing
View Details
PE-Cy7 anti-human CD45
MBS9471628-01 25 Tests

PE-Cy7 anti-human CD45

Sign In for Pricing
View Details
PE-Cy7 anti-human CD45
MBS9471628-02 100 Tests

PE-Cy7 anti-human CD45

Sign In for Pricing
View Details