Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 1 protein
MBS5304550-01 25 Units

Caspase 1 protein

Sign In for Pricing
View Details
Caspase 1 protein
MBS5304550-02 5x 25 Units

Caspase 1 protein

Sign In for Pricing
View Details
ON1231320 (Standard)
HY-100789R 1 Each

ON1231320 (Standard)

Sign In for Pricing
View Details
Human Retinoblastoma-like protein 1 (RBL1) ELISA Kit
abx250655 96 Tests

Human Retinoblastoma-like protein 1 (RBL1) ELISA Kit

Sign In for Pricing
View Details
Goose Pannexin-1 (PANX1) ELISA Kit
MBS9942959 Inquire

Goose Pannexin-1 (PANX1) ELISA Kit

Sign In for Pricing
View Details
Goat N-chimaerin (CHN1) ELISA Kit
EIA06820Go 1 Kit

Goat N-chimaerin (CHN1) ELISA Kit

Sign In for Pricing
View Details