Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ruvbl1 Mouse shRNA Plasmid (Locus ID 56505)
TL509291 1 Kit

Ruvbl1 Mouse shRNA Plasmid (Locus ID 56505)

Sign In for Pricing
View Details
Polyclonal Antibody to CDK6 (Ab-24)
35-1746-50 50 μL

Polyclonal Antibody to CDK6 (Ab-24)

Sign In for Pricing
View Details
N-myc proto-oncogene protein (MYCN) Mouse ELISA Kit
F2348 96 Tests

N-myc proto-oncogene protein (MYCN) Mouse ELISA Kit

Sign In for Pricing
View Details
Oxsr1, NT (Oxsr1, Osr1, Serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein) (Azide free) (HRP)
MBS6330047-01 0.2 mL

Oxsr1, NT (Oxsr1, Osr1, Serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein) (Azide free) (HRP)

Sign In for Pricing
View Details
Oxsr1, NT (Oxsr1, Osr1, Serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein) (Azide free) (HRP)
MBS6330047-02 5x 0.2 mL

Oxsr1, NT (Oxsr1, Osr1, Serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein) (Azide free) (HRP)

Sign In for Pricing
View Details
Easypro Human Engulfment And Cell Motility 2 (ELMO2) ELISA Kit
FY-EH1875S 96 Well

Easypro Human Engulfment And Cell Motility 2 (ELMO2) ELISA Kit

Sign In for Pricing
View Details