Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CTHRC1 Antibody [Alexa Fluor 488]
NBP2-81744AF488 0.1 mL

Rabbit Polyclonal CTHRC1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Cardiotrophin 1, Mouse, Recombinant (CT1)
MBS650178-01 0.002 mg

Cardiotrophin 1, Mouse, Recombinant (CT1)

Sign In for Pricing
View Details
Cardiotrophin 1, Mouse, Recombinant (CT1)
MBS650178-02 0.01 mg

Cardiotrophin 1, Mouse, Recombinant (CT1)

Sign In for Pricing
View Details
Cardiotrophin 1, Mouse, Recombinant (CT1)
MBS650178-03 5x 0.01 mg

Cardiotrophin 1, Mouse, Recombinant (CT1)

Sign In for Pricing
View Details
Guca2b (NM_022284) Rat Tagged Lenti ORF Clone
RR204854L3 10 µg

Guca2b (NM_022284) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AKT1 Antibody
MBS9602731-01 0.05 mL

AKT1 Antibody

Sign In for Pricing
View Details