Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Acetobutylicum def2 Protein (aa 1-150)
VAng-Lsx7548-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Acetobutylicum def2 Protein (aa 1-150)

Sign In for Pricing
View Details
Rat CD302 siRNA
abx911007-01 15 nmol

Rat CD302 siRNA

Sign In for Pricing
View Details
Rat CD302 siRNA
abx911007-02 30 nmol

Rat CD302 siRNA

Sign In for Pricing
View Details
Rabbit Polyclonal UBN1 Antibody [Janelia Fluor 549]
NBP1-49983JF549 0.1 mL

Rabbit Polyclonal UBN1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Human ZNF620 knockout cell line
ABC-KH17680 1 Vial

Human ZNF620 knockout cell line

Sign In for Pricing
View Details
Human Synaptotagmin-6 (SYT6) ELISA Kit
EIA06929h 1 Kit

Human Synaptotagmin-6 (SYT6) ELISA Kit

Sign In for Pricing
View Details