CEACAM7, Human (HEK293, His)
CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CEACAM7 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html
Purity
98.0
Smiles
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF
Molecular Formula
1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)
Molecular Weight
20-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal Aggrecan Neoepitope Antibody [Janelia Fluor 646]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Rabbit Polyclonal Aggrecan Neoepitope Antibody [Janelia Fluor 646]
![Rabbit Polyclonal PACS1 Antibody [Alexa Fluor 750]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Rabbit Polyclonal PACS1 Antibody [Alexa Fluor 750]
Di-tert-Butyldicarbonate (BOC Anhydride, DiBOC) extrapure, 98.5 -101.5%
Di-tert-Butyldicarbonate (BOC Anhydride, DiBOC) extrapure, 98.5 -101.5%
Di-tert-Butyldicarbonate (BOC Anhydride, DiBOC) extrapure, 98.5 -101.5%