Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal beta II Tubulin B Antibody (OTI6D11) [Biotin]
NBP2-72505B 0.1 mL

Mouse Monoclonal beta II Tubulin B Antibody (OTI6D11) [Biotin]

Sign In for Pricing
View Details
Cfi Mouse siRNA Oligo Duplex (Locus ID 12630)
SR418069 1 Kit

Cfi Mouse siRNA Oligo Duplex (Locus ID 12630)

Sign In for Pricing
View Details
Human/Mouse SOX2 MAb (Clone 245610R)
MAB2018R-100 100 µg

Human/Mouse SOX2 MAb (Clone 245610R)

Sign In for Pricing
View Details
Glutathione S-Transferase Alpha 2 (GSTa2) Recombinant, Human
154805-01 10 µg

Glutathione S-Transferase Alpha 2 (GSTa2) Recombinant, Human

Sign In for Pricing
View Details
Glutathione S-Transferase Alpha 2 (GSTa2) Recombinant, Human
154805-02 50 µg

Glutathione S-Transferase Alpha 2 (GSTa2) Recombinant, Human

Sign In for Pricing
View Details
Glutathione S-Transferase Alpha 2 (GSTa2) Recombinant, Human
154805-03 200 µg

Glutathione S-Transferase Alpha 2 (GSTa2) Recombinant, Human

Sign In for Pricing
View Details