CEACAM7, Human (HEK293, His)
CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CEACAM7 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html
Purity
98.0
Smiles
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF
Molecular Formula
1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)
Molecular Weight
20-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
SLC7A2 sgRNA CRISPR Lentivector (Human) (Target 3)
Enolase 1 (ENO1, 2-phospho-D-glycerate Hydro-lyase, alpha Enolase, C-myc Promoter-binding Protein, ENO1L1, MBP-1, MBPB1, MPB1, Non-neural Enolase, NNE, Phosphopyruvate Hydratase, PPH, Plasminogen-binding Protein) (HRP)
Human Stromal membrane-associated protein 2, SMAP2 ELISA Kit
Human Stromal membrane-associated protein 2, SMAP2 ELISA Kit