Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html

Purity

98.0

Smiles

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Molecular Formula

1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1110038F14Rik (NM_054099) Mouse Untagged Clone
MC204695 10 µg

1110038F14Rik (NM_054099) Mouse Untagged Clone

Sign In for Pricing
View Details
p21 Ras (HRAS) (NM_001130442) Human Tagged Lenti ORF Clone
RC225202L3 10 µg

p21 Ras (HRAS) (NM_001130442) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human ABTB2 shRNA (UAS) - Lentiviral human ABTB2 shRNA (UAS, GFP) (25)
GTR15107900 1 Vial

Lentiviral human ABTB2 shRNA (UAS) - Lentiviral human ABTB2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Glucagon-like Peptide 2 Receptor, Human, Control Peptide (GLP2R)
G2040-39K 100 µg

Glucagon-like Peptide 2 Receptor, Human, Control Peptide (GLP2R)

Sign In for Pricing
View Details
DFFA Antibody
ABD7947 100 µg

DFFA Antibody

Sign In for Pricing
View Details
Rat PROC (Protein C) CLIA Kit
MBS2530927-01 96 Tests

Rat PROC (Protein C) CLIA Kit

Sign In for Pricing
View Details