CEACAM7, Human (HEK293, His)
CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CEACAM7 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ceacam7-protein-human-hek-293-his.html
Purity
98.0
Smiles
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF
Molecular Formula
1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)
Molecular Weight
20-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Lentiviral mouse Prcd shRNA (UAS) - Lentiviral mouse Prcd shRNA (UAS, RFP) (100)
PIST, ID (Golgi-associated PDZ and Coiled-coil Motif-containing Protein, PDZ Protein Interacting Specifically with TC10, CFTR-associated Ligand, Fused in Glioblastoma, GOPC, CAL, FIG) (MaxLight 750)
PIST, ID (Golgi-associated PDZ and Coiled-coil Motif-containing Protein, PDZ Protein Interacting Specifically with TC10, CFTR-associated Ligand, Fused in Glioblastoma, GOPC, CAL, FIG) (MaxLight 750)
Recombinant Macaca fascicularis 26S protease regulatory subunit 6B (PSMC4)
Recombinant Macaca fascicularis 26S protease regulatory subunit 6B (PSMC4)