Leptin, Mouse
Leptin Protein, Mouse is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.
Product Specifications
Product Name Alternative
Leptin Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/leptin-protein-mouse.html
Purity
98.00
Smiles
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Molecular Formula
16846 (Gene_ID) Q544U0 (V22-C167) (Accession)
Molecular Weight
Approximately 14 kDa band in SDS-PAGE under reducing conditions
References & Citations
[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2355106 1.0 µg DNA
TDRD10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details K6644904 1.0 µg DNA
RGD1311249 sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details GTR10336362 96 Well
Mouse Olfactory receptor 10R2 (OR10R2) ELISA Kit
Sign In for Pricing
View Details