Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Mouse

Leptin Protein, Mouse is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Product Specifications

Product Name Alternative

Leptin Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-mouse.html

Purity

98.00

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Formula

16846 (Gene_ID) Q544U0 (V22-C167) (Accession)

Molecular Weight

Approximately 14 kDa band in SDS-PAGE under reducing conditions

References & Citations

[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP1 Antibody
GWB-MV457G 50 µg

CASP1 Antibody

Sign In for Pricing
View Details
RalA Antibody
CST 3526S 100 µL

RalA Antibody

Sign In for Pricing
View Details
Human/Mouse/Rat PKC alpha Affinity Purified Polyclonal Ab
AF5340-SP 25 µg

Human/Mouse/Rat PKC alpha Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Mouse Dentin Sialo protein ELISA Kit
MBS738339-01 48 Well

Mouse Dentin Sialo protein ELISA Kit

Sign In for Pricing
View Details
Mouse Dentin Sialo protein ELISA Kit
MBS738339-02 96 Well

Mouse Dentin Sialo protein ELISA Kit

Sign In for Pricing
View Details
Mouse Dentin Sialo protein ELISA Kit
MBS738339-03 5x 96 Well

Mouse Dentin Sialo protein ELISA Kit

Sign In for Pricing
View Details