Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Mouse

Leptin Protein, Mouse is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Product Specifications

Product Name Alternative

Leptin Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-mouse.html

Purity

98.00

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Formula

16846 (Gene_ID) Q544U0 (V22-C167) (Accession)

Molecular Weight

Approximately 14 kDa band in SDS-PAGE under reducing conditions

References & Citations

[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF284L siRNA (h)
sc-97319 10 µM

ZNF284L siRNA (h)

Sign In for Pricing
View Details
ELF3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0674003 1.0 µg DNA

ELF3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Hydroxychloroquine (HCQ) Monoclonal Antibody
CAU36399-01 100 µL

Hydroxychloroquine (HCQ) Monoclonal Antibody

Sign In for Pricing
View Details
Hydroxychloroquine (HCQ) Monoclonal Antibody
CAU36399-02 200 µL

Hydroxychloroquine (HCQ) Monoclonal Antibody

Sign In for Pricing
View Details
Hydroxychloroquine (HCQ) Monoclonal Antibody
CAU36399-03 1 mL

Hydroxychloroquine (HCQ) Monoclonal Antibody

Sign In for Pricing
View Details
RAD23A siRNA (Mouse)
CRM3387-01 15 nmol

RAD23A siRNA (Mouse)

Sign In for Pricing
View Details