Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Mouse

Leptin Protein, Mouse is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Product Specifications

Product Name Alternative

Leptin Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-mouse.html

Purity

98.00

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Formula

16846 (Gene_ID) Q544U0 (V22-C167) (Accession)

Molecular Weight

Approximately 14 kDa band in SDS-PAGE under reducing conditions

References & Citations

[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RET1 ELISA Kit
E105229 1 Each

Human RET1 ELISA Kit

Sign In for Pricing
View Details
CLEC5A Rabbit Polyclonal Antibody (Biotin)
orb447652 100 µL

CLEC5A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Fzd1 sgRNA CRISPR Lentivector set (Mouse)
K4518901 3x 1.0 µg

Fzd1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O9:H4 (strain HS) gpt Polyclonal Antibody
MBS7169192 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) gpt Polyclonal Antibody

Sign In for Pricing
View Details
Hrs HDR Plasmid (m)
sc-420851-HDR 20 µg

Hrs HDR Plasmid (m)

Sign In for Pricing
View Details
Mouse Immunoglobulin G (IgG) ELISA Kit
orb775255-01 48 Tests

Mouse Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details