Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300LF, Human (His)

The CD300LF protein acts as a multifunctional immunomodulator, acting as an inhibitory receptor on myeloid cells and mast cells. It plays a vital role in immune homeostasis by actively regulating the phagocytosis of apoptotic cells by binding to phosphatidylserine. CD300LF Protein, Human (His) is the recombinant human-derived CD300LF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD300LF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd300lf-protein-human-his.html

Purity

90.00

Smiles

TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Molecular Formula

146722 (Gene_ID) Q8TDQ1-1 (T20-S156) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)
234633-01 250 mg

6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)

Sign In for Pricing
View Details
6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)
234633-02 1 g

6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)

Sign In for Pricing
View Details
6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)
234633-03 5 g

6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)

Sign In for Pricing
View Details
6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)
234633-04 10 g

6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)

Sign In for Pricing
View Details
6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)
234633-05 25 g

6-Chloro-4-hydroxyquinoline-3-carboxylic acid 98+% (HPLC)

Sign In for Pricing
View Details
TBK1 Antibody
A22482-50UG 50 µg

TBK1 Antibody

Sign In for Pricing
View Details