Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP2, Human (His)

The TPPP2 protein may be a regulator of microtubule dynamics and is critical for sperm motility. Unlike other family members, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role. TPPP2 Protein, Human (His) is the recombinant human-derived TPPP2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TPPP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tppp2-protein-human-his.html

Purity

91.00

Smiles

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK

Molecular Formula

122664 (Gene_ID) P59282 (M1-K170) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

dl-Alpha-Tocopherol Acetate
TRC-T526155-50G 50 g

dl-Alpha-Tocopherol Acetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Gallbladder
CS709025 5x 5 µm

Tissue FFPE Sections, Gallbladder

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), 0.2mg/mL
BNUB1384-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), 0.2mg/mL

Sign In for Pricing
View Details
Cytochrome p450 (M12P4H2), Biotin conjugate, 0.1mg/mL
BNCB2199-100 1x 100 µL

Cytochrome p450 (M12P4H2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GABRA1 Recombinant Mouse monoclonal Antibody
HA610227 100 µg

GABRA1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
CD274 Human Recombinant Protein
TP721255M 100 µg

CD274 Human Recombinant Protein

Sign In for Pricing
View Details