Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP2, Human (His)

The TPPP2 protein may be a regulator of microtubule dynamics and is critical for sperm motility. Unlike other family members, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role. TPPP2 Protein, Human (His) is the recombinant human-derived TPPP2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TPPP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tppp2-protein-human-his.html

Purity

91.00

Smiles

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK

Molecular Formula

122664 (Gene_ID) P59282 (M1-K170) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prss53 sgRNA CRISPR Lentivector set (Rat)
K6492901 3x 1.0 µg

Prss53 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit
MBS9911036-01 48 Well

Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit

Sign In for Pricing
View Details
Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit
MBS9911036-02 96 Well

Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit

Sign In for Pricing
View Details
Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit
MBS9911036-03 5x 96 Well

Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit

Sign In for Pricing
View Details
Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit
MBS9911036-04 10x 96 Well

Rat Fibrosin Antibody (Anti-FBRS) ELISA Kit

Sign In for Pricing
View Details
PCDHGC4 Antibody
orb1245007 100 µL

PCDHGC4 Antibody

Sign In for Pricing
View Details