Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Mouse (140a.a, HEK293, His)

The CD47 protein is an adhesive multifunctional protein that coordinates cell-cell interactions, serves as a THBS1 receptor, and regulates integrin signaling through heterotrimeric G proteins.It plays a key role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, immune regulation, and memory formation. CD47 Protein, Mouse (140a.a, HEK293, His) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD47 Protein, Mouse (140a.a, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP

Molecular Formula

16423 (Gene_ID) Q61735-2 (Q19-P158) (Accession)

Molecular Weight

30-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM3B antibody
70R-18091 50 μL

KDM3B antibody

Sign In for Pricing
View Details
HRAS Antibody
ABD7960 100 µg

HRAS Antibody

Sign In for Pricing
View Details
DSC2 Knockout HGC-27 Polyclonal Cells
ARG39800 1 Million

DSC2 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Nunc Microwell 96-Well Polystyrene Round Bottom Plates Nunclon Sphera Treated
174925 8 / PCK

Nunc Microwell 96-Well Polystyrene Round Bottom Plates Nunclon Sphera Treated

Sign In for Pricing
View Details
NCAM1 Protein Vector (Human) (pPM-C-HA)
31533021 500 ng

NCAM1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human Sirtuin 7 (SIRT7) ELISA Kit
RDR-SIRT7-Hu-48Tests 48 Tests

Human Sirtuin 7 (SIRT7) ELISA Kit

Sign In for Pricing
View Details