Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein E6, HPV16 (His)

HPV16 E6 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E6 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E6 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E6, HPV16 (His) is a recombinant HPV E6 protein expressed from E. coli with an N-6*His tag.

Product Specifications

Product Name Alternative

Protein E6, HPV16 (His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-e6-human-his.html

Purity

98.00

Smiles

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

Molecular Formula

1489078 (Gene_ID) P03126 (M1-L158) (Accession)

Molecular Weight

Approximately 21 kDa

References & Citations

[1]Androphy EJ, et al. Identification of the HPV-16 E6 protein from transformed mouse cells and human cervical carcinoma cell lines. EMBO J. 1987 Apr;6 (4) :989-92.|[2]Boulenouar S, et al. Effects of HPV-16 E5, E6 and E7 proteins on survival, adhesion, migration and invasion of trophoblastic cells. Carcinogenesis. 2010 Mar;31 (3) :473-80.|[3]Duerksen-Hughes PJ, et al. HPV 16 E6 blocks TNF-mediated apoptosis in mouse fibroblast LM cells. Virology. 1999 Nov 10;264 (1) :55-65.|[4]Hu D, et al. HPV-16 E6/E7 promotes cell migration and invasion in cervical cancer via regulating cadherin switch in vitro and in vivo. Arch Gynecol Obstet. 2015 Dec;292 (6) :1345-54.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLD1 Human Gene Knockout Kit (CRISPR)
KN401238 1 Kit

POLD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NXPH1 Rabbit Polyclonal Antibody
AP32310PU-N 50 µL

NXPH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIPK1 (C-term) Rabbit Polyclonal Antibody
AP52049PU-N 400 µL

HIPK1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,5-Bis(2,2,2-trifluoroethoxy)benzoic Acid-d4
TRC-B585488-25MG 25 mg

2,5-Bis(2,2,2-trifluoroethoxy)benzoic Acid-d4

Sign In for Pricing
View Details
MDH1 Rabbit Polyclonal Antibody
TA378416 100 µL

MDH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTOR Rabbit Polyclonal Antibody
AP06628PU-N 100 µg

MTOR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details