Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G7, Mouse (HEK293, His, Myc)

The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups.PLA2G7 Protein, Mouse (HEK293, His, Myc) is the recombinant mouse-derived PLA2G7 protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G7 Protein, Mouse (HEK293, His, Myc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g7-protein-mouse-hek293-n-his-c-myc.html

Smiles

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Molecular Formula

27226 (Gene_ID) Q60963 (F22-N440) (Accession)

Molecular Weight

51.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine SP ELISA Kit
ECS0016 96 Tests

Canine SP ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Mtm1 shRNA (UAS) - Lentiviral mouse Mtm1 shRNA (UAS, GFP) plasmid
GTR15282406 1 Vial

Lentiviral mouse Mtm1 shRNA (UAS) - Lentiviral mouse Mtm1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Dog CD5 Antibody
GWB-Q01384 0.25 mg

Dog CD5 Antibody

Sign In for Pricing
View Details
PACE4 (PCSK6) (NM_138325) Human Tagged ORF Clone
RC217311 10 µg

PACE4 (PCSK6) (NM_138325) Human Tagged ORF Clone

Sign In for Pricing
View Details
α-tubulin discontinued
347172-01 100 µL

α-tubulin discontinued

Sign In for Pricing
View Details
α-tubulin discontinued
347172-02 200 µL

α-tubulin discontinued

Sign In for Pricing
View Details