Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G7, Mouse (HEK293, His, Myc)

The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups.PLA2G7 Protein, Mouse (HEK293, His, Myc) is the recombinant mouse-derived PLA2G7 protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G7 Protein, Mouse (HEK293, His, Myc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g7-protein-mouse-hek293-n-his-c-myc.html

Smiles

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Molecular Formula

27226 (Gene_ID) Q60963 (F22-N440) (Accession)

Molecular Weight

51.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cellulase (CL) Assay Kit
E47S197 100 Tests - 48 Samples

Cellulase (CL) Assay Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ORAI3 Antibody
NBP1-93523-25ul 25 µL

Rabbit Polyclonal ORAI3 Antibody

Sign In for Pricing
View Details
Recombinant Human PPP3R2 Protein, N-His
YHK56401 100 μg

Recombinant Human PPP3R2 Protein, N-His

Sign In for Pricing
View Details
Pfkfb3 (NM_001177757) Mouse Tagged ORF Clone Lentiviral Particle
MR208437L4V 200 µL

Pfkfb3 (NM_001177757) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Stem Cell Growth Factor beta (SCGFb) (AP) discontinued
S7973-30A-AP 100 µL

Stem Cell Growth Factor beta (SCGFb) (AP) discontinued

Sign In for Pricing
View Details
Esrra (NM_001008511) Rat Tagged Lenti ORF Clone
RR215141L4 10 µg

Esrra (NM_001008511) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details