Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 S glycoprotein (V483A, HEK293, His)

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.

Product Specifications

Product Name Alternative

SARS-CoV-2 S glycoprotein (V483A, HEK293, His), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-s-glycoprotein-v483a-hek-293-his.html

Smiles

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Molecular Formula

43740568 (Gene_ID) P0DTC2 (R319-F541, V483A) (Accession)

Molecular Weight

Approximately 27.8 kDa

References & Citations

[1]Shen S, et al. Expression, glycosylation, and modification of the spike (S) glycoprotein of SARS CoV. Methods Mol Biol. 2007;379:127-135.|[2]Wang S, et al. AXL is a candidate receptor for SARS-CoV-2 that promotes infection of pulmonary and bronchial epithelial cells. Cell Res. 2021;31 (2) :126-140.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF11B Human qPCR Primer Pair (XM_058399)
HP220811 200 Reactions

ZNF11B Human qPCR Primer Pair (XM_058399)

Sign In for Pricing
View Details
AGAP9 (N-term) Rabbit Polyclonal Antibody
AP50108PU-N 400 µL

AGAP9 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MST1 (C-term) Rabbit Polyclonal Antibody
AP52761PU-N 400 µL

MST1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDK2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A8]
TA502943BM 100 µL

CDK2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS504721 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
4-Acetyl-L-phenylalanine Hydrochloride
TRC-A187540-250MG 250 mg

4-Acetyl-L-phenylalanine Hydrochloride

Sign In for Pricing
View Details