Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP3, Human (His)

DUSP3, a dual-specificity phosphatase, preferentially dephosphorylates phosphotyrosines. Its main function involves inactivating ERK1 and ERK2, thereby modulating associated cellular signaling pathways. DUSP3 Protein, Human (His) is the recombinant human-derived DUSP3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

DUSP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dusp3-protein-human-his.html

Purity

97.00

Smiles

SGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

Molecular Formula

1845 (Gene_ID) P51452-1 (S2-P185) (Accession)

Molecular Weight

18-22 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine V-type proton ATPase subunit B, kidney isoform (ATP6V1B1) , partial
MBS718016 Inquire

Recombinant Bovine V-type proton ATPase subunit B, kidney isoform (ATP6V1B1) , partial

Sign In for Pricing
View Details
UBE2D3P4 Protein Vector (Human) (pPB-N-His)
PV141583 500 ng

UBE2D3P4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human ITGB3 protein
MBS1561333-01 0.05 mg

Recombinant Human ITGB3 protein

Sign In for Pricing
View Details
Recombinant Human ITGB3 protein
MBS1561333-02 0.1 mg

Recombinant Human ITGB3 protein

Sign In for Pricing
View Details
Recombinant Human ITGB3 protein
MBS1561333-03 5x 0.1 mg

Recombinant Human ITGB3 protein

Sign In for Pricing
View Details
Igfbpl1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3247402 1.0 µg DNA

Igfbpl1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details