DUSP3, Human (His)
DUSP3, a dual-specificity phosphatase, preferentially dephosphorylates phosphotyrosines. Its main function involves inactivating ERK1 and ERK2, thereby modulating associated cellular signaling pathways. DUSP3 Protein, Human (His) is the recombinant human-derived DUSP3 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
DUSP3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dusp3-protein-human-his.html
Purity
97.00
Smiles
SGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Molecular Formula
1845 (Gene_ID) P51452-1 (S2-P185) (Accession)
Molecular Weight
18-22 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6207984-01 0.1 mL
POLA2 (Polymerase (DNA Directed), alpha 2 (70kD Subunit), FLJ21662, FLJ37250) (MaxLight 490)
Sign In for Pricing
View Details MBS6207984-02 5x 0.1 mL
POLA2 (Polymerase (DNA Directed), alpha 2 (70kD Subunit), FLJ21662, FLJ37250) (MaxLight 490)
Sign In for Pricing
View Details 
MBS1403554-01 0.5 mg (E-Coli)
Recombinant Human TOMM20-like protein 1 (TOMM20L), partial
Sign In for Pricing
View Details MBS1403554-02 0.05 mg (Baculovirus)
Recombinant Human TOMM20-like protein 1 (TOMM20L), partial
Sign In for Pricing
View Details