Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP3, Human (His)

DUSP3, a dual-specificity phosphatase, preferentially dephosphorylates phosphotyrosines. Its main function involves inactivating ERK1 and ERK2, thereby modulating associated cellular signaling pathways. DUSP3 Protein, Human (His) is the recombinant human-derived DUSP3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

DUSP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dusp3-protein-human-his.html

Purity

97.00

Smiles

SGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

Molecular Formula

1845 (Gene_ID) P51452-1 (S2-P185) (Accession)

Molecular Weight

18-22 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dctd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4525606 1.0 µg DNA

Dctd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Ring Finger Protein 138 (RNF138) Antibody
abx126486-01 20 µL

Ring Finger Protein 138 (RNF138) Antibody

Sign In for Pricing
View Details
Ring Finger Protein 138 (RNF138) Antibody
abx126486-02 100 µL

Ring Finger Protein 138 (RNF138) Antibody

Sign In for Pricing
View Details
Ring Finger Protein 138 (RNF138) Antibody
abx126486-03 2x 100 µL

Ring Finger Protein 138 (RNF138) Antibody

Sign In for Pricing
View Details
Biotinylated Anti-KAAG1 (olintatug biosimilar) mAb
MBS1881970-01 0.05 mg

Biotinylated Anti-KAAG1 (olintatug biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-KAAG1 (olintatug biosimilar) mAb
MBS1881970-02 0.1 mg

Biotinylated Anti-KAAG1 (olintatug biosimilar) mAb

Sign In for Pricing
View Details