Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 2 (BRD2), partial

Product Specifications

Product Name Alternative

Really interesting new gene 3 protein

Abbreviation

Recombinant Human BRD2 protein, partial

Gene Name

BRD2

UniProt

P25440

Expression Region

339-459aa

Organism

Homo sapiens (Human)

Target Sequence

QSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in spermatogenesis or folliculogenesis. Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF-3 (phospho Ser396) Rabbit Polyclonal Antibody
E28PP0326 100 µL

IRF-3 (phospho Ser396) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
THBS2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV640980 1.0 µg DNA

THBS2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
KOR-1 (D-8) Alexa Fluor® 647
sc-374479 AF647 200 µg/mL

KOR-1 (D-8) Alexa Fluor® 647

Sign In for Pricing
View Details
Rat OLR1073 siRNA
abx926920-01 15 nmol

Rat OLR1073 siRNA

Sign In for Pricing
View Details
Rat OLR1073 siRNA
abx926920-02 30 nmol

Rat OLR1073 siRNA

Sign In for Pricing
View Details
MND1 CRISPR Activation Plasmid (m2)
sc-429456-ACT-2 20 µg

MND1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details