Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Mouse (HEK293, C-His)

TIMP-2 is a tissue inhibitor of metalloproteinases that forms complexes with metalloproteinases, especially collagenases, effectively and irreversibly inactivating them by binding to their catalytic zinc cofactor.This interaction plays a crucial role in regulating the activity of metalloproteinases.TIMP-2 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-mouse-hek293-c-his.html

Purity

95.0

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

21858 (Gene_ID) P25785 (C27-P220) (Accession)

Molecular Weight

Approximately 21.41 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rab11fip4 shRNA (UAS) - Lentiviral mouse Rab11fip4 shRNA (UAS, iRFP) plasmid
GTR15291592 1 Vial

Lentiviral mouse Rab11fip4 shRNA (UAS) - Lentiviral mouse Rab11fip4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
IGF-1R inhibitor-5
orb2945826-01 50 mg

IGF-1R inhibitor-5

Sign In for Pricing
View Details
IGF-1R inhibitor-5
orb2945826-02 10 mg

IGF-1R inhibitor-5

Sign In for Pricing
View Details
SMARCA1 Rabbit pAb
E45R17871N 50 ul

SMARCA1 Rabbit pAb

Sign In for Pricing
View Details
Dyx1c1 (NM_026314) Mouse Tagged ORF Clone Lentiviral Particle
MR206674L4V 200 µL

Dyx1c1 (NM_026314) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GPR142 (NM_181790) Human Over-expression Lysate
LH15808V 100 µg

GPR142 (NM_181790) Human Over-expression Lysate

Sign In for Pricing
View Details