Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Mouse (CHO, His)

SFRP1 Protein is a secreted glycoprotein member of the SFRP family.SFRP1 Protein can act as an inhibitor of Wnt signaling and is capable of resisting vascular cell proliferation.SFRP1 Protein, Mouse (CHO, His) is the recombinant mouse-derived SFRP1 protein, expressed by CHO , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-mouse-cho-his.html

Purity

97.90

Smiles

SEYDYVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKALVLFLKNGADCPCHQLDNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRMKNHECPTFQSVFK

Molecular Formula

20377 (Gene_ID) AAC53145.1 (S32-K314) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cystatin 4 (CST4) ELISA Kit
DLR-CST4-Hu-96T 96 Tests

Human Cystatin 4 (CST4) ELISA Kit

Sign In for Pricing
View Details
Heparan-α-glucosaminide N-Acetyl transferase (HGSNAT) Human ELISA Kit
D9857 96 Tests

Heparan-α-glucosaminide N-Acetyl transferase (HGSNAT) Human ELISA Kit

Sign In for Pricing
View Details
SIRT7 Antibody
MBS544905-01 0.1 mg

SIRT7 Antibody

Sign In for Pricing
View Details
SIRT7 Antibody
MBS544905-02 5x 0.1 mg

SIRT7 Antibody

Sign In for Pricing
View Details
C6orf150 (MB21D1) Human Gene Knockout Kit (CRISPR)
KN212386 1 Kit

C6orf150 (MB21D1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARGLU1 Protein Vector (Human) (pPM-C-HA)
12274021 500 ng

ARGLU1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details