Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (P. pastoris, N-His)

FGF basic, or bFGF (fibroblast growth factor basic), initiates at an alternative CUG codon, marking a distinctive feature in translational initiation. This alternative start codon plays a pivotal role in regulating the expression and functional properties of FGF basic. FGF basic/bFGF Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGF basic/bFGF protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf2-protein-human-p-pastoris-n-his.html

Purity

98.0

Smiles

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (P143-S288) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nalgene Flask PETG 250ml Plain
FLA2106 12 / PCK

Nalgene Flask PETG 250ml Plain

Sign In for Pricing
View Details
VE Cadherin Rabbit Monoclonal Antibody
E56G2059 100 µL

VE Cadherin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Wortmannin, Penicillium funiculosum
1670-1 1 mg

Wortmannin, Penicillium funiculosum

Sign In for Pricing
View Details
HLA-DRA Antibody
OAEE01044-100T 100 Tests

HLA-DRA Antibody

Sign In for Pricing
View Details
Torachrysone 8-O-glucoside
MT15652-01 1 mg

Torachrysone 8-O-glucoside

Sign In for Pricing
View Details
Torachrysone 8-O-glucoside
MT15652-02 2 mg

Torachrysone 8-O-glucoside

Sign In for Pricing
View Details