Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 beta/CCL19, Mouse (sf9, His)

MIP-3 beta/CCL19 Protein, Mouse (sf9, His) is a CC chemokine that is strongly chemotactic for CD4 T cells and CD8 T cells and acts as a ligand that binds specifically to the chemokine receptor CCR7 to mediate tissue immunity, inflammatory responses, and antiviral infections. MIP-3 beta/CCL19 Protein, Mouse (sf9, His) is a recombinant mouse MIP-3 beta/CCL19 (G26-S108) protein expressed by Sf9 insect cells with a his tag at the C-terminus[1][2].

Product Specifications

Product Name Alternative

MIP-3 beta/CCL19 Protein, Mouse (sf9, His), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-beta-ccl19-protein-mouse-108a-a-his.html

Purity

98.0

Smiles

MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS

Molecular Formula

24047 (Gene_ID) O70460 (G26-S108) (Accession)

Molecular Weight

Approximately 10.7 kDa

References & Citations

[1]Yan Yan, et al. CCL19 and CCR7 Expression, Signaling Pathways, and Adjuvant Functions in Viral Infection and Prevention. Front Cell Dev Biol. 2019 Oct 1;7:212.|[2]Naomi Yamashita, et al. Role of CCL21 and CCL19 in allergic inflammation in the ovalbumin-specific murine asthmatic model. J Allergy Clin Immunol. 2006 May;117 (5) :1040-6|[3]Benjamin J Marsland, et al. CCL19 and CCL21 induce a potent proinflammatory differentiation program in licensed dendritic cells. Immunity. 2005 Apr;22 (4) :493-505.|[4]Yan Yan, et al. CCL19 enhances CD8+ T-cell responses and accelerates HBV clearance. J Gastroenterol. 2021 Aug;56 (8) :769-785.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Minibrain Rabbit pAb, AP conjugated
orb2848497 100 µL

Minibrain Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
5-Chloro-3-phenyl-1- (propan-2-yl) -1H-pyrazole
VJC98192-01 50 mg

5-Chloro-3-phenyl-1- (propan-2-yl) -1H-pyrazole

Sign In for Pricing
View Details
5-Chloro-3-phenyl-1- (propan-2-yl) -1H-pyrazole
VJC98192-02 0.5 g

5-Chloro-3-phenyl-1- (propan-2-yl) -1H-pyrazole

Sign In for Pricing
View Details
Btnl3 Rat shRNA Lentiviral Particle (Locus ID 407781)
TL700452V 500 µL Each

Btnl3 Rat shRNA Lentiviral Particle (Locus ID 407781)

Sign In for Pricing
View Details
Recombinant Apolipoprotein C3 (APOC3)
MBS2140018-01 0.01 mg

Recombinant Apolipoprotein C3 (APOC3)

Sign In for Pricing
View Details
Recombinant Apolipoprotein C3 (APOC3)
MBS2140018-02 0.05 mg

Recombinant Apolipoprotein C3 (APOC3)

Sign In for Pricing
View Details