CD28, Mouse (HEK293, Fc-His)
CD28 Protein, a crucial regulator of T-cell activation, promotes cell proliferation, cytokine production, and T-cell survival. It enhances IL4 and IL10 production when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a disulfide-linked homodimer and interacts with DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2 (By similarity) . CD28 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived CD28 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD28 Protein, Mouse (HEK293, Fc-His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd28-protein-mouse-hek-293-fc-his.html
Purity
98.0
Smiles
NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
Molecular Formula
12487 (Gene_ID) P31041 (N20-K149) (Accession)
Molecular Weight
Approximately 58.0-60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
