Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28, Mouse (HEK293, Fc-His)

CD28 Protein, a crucial regulator of T-cell activation, promotes cell proliferation, cytokine production, and T-cell survival. It enhances IL4 and IL10 production when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a disulfide-linked homodimer and interacts with DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2 (By similarity) . CD28 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived CD28 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD28 Protein, Mouse (HEK293, Fc-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd28-protein-mouse-hek-293-fc-his.html

Purity

98.0

Smiles

NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK

Molecular Formula

12487 (Gene_ID) P31041 (N20-K149) (Accession)

Molecular Weight

Approximately 58.0-60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLK1 (C-Term) Rabbit pAb
MBS8556241-01 0.1 mL

DLK1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
DLK1 (C-Term) Rabbit pAb
MBS8556241-02 0.1 mL (AF405L)

DLK1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
DLK1 (C-Term) Rabbit pAb
MBS8556241-03 0.1 mL (AF405S)

DLK1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
DLK1 (C-Term) Rabbit pAb
MBS8556241-04 0.1 mL (AF610)

DLK1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
DLK1 (C-Term) Rabbit pAb
MBS8556241-05 0.1 mL (AF635)

DLK1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
DLK1 (C-Term) Rabbit pAb
MBS8556241-06 0.1 mL (APC)

DLK1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details