Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 5B (EIF5B), partial

Product Specifications

Product Name Alternative

(eIF-5B) (Translation initiation factor IF-2)

Abbreviation

Recombinant Human EIF5B protein, partial

Gene Name

EIF5B

UniProt

O60841

Expression Region

629-846aa

Organism

Homo sapiens (Human)

Target Sequence

LRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTML

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Plays a role in translation initiation. Translational GTPase that catalyzes the joining of the 40S and 60S subunits to form the 80S initiation complex with the initiator methionine-tRNA in the P-site base paired to the start codon. GTP binding and hydrolysis induces conformational changes in the enzyme that renders it active for productive interactions with the ribosome. The release of the enzyme after formation of the initiation complex is a prerequisite to form elongation-competent ribosomes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.3 kDa

References & Citations

"The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT14/KRT16 Antibody
CSB-PA009664-01 50 µg

KRT14/KRT16 Antibody

Sign In for Pricing
View Details
KRT14/KRT16 Antibody
CSB-PA009664-02 100 µg

KRT14/KRT16 Antibody

Sign In for Pricing
View Details
Transforming Growth Factor Beta-1 (TGFB1) Antibody
abx239898 100 µg

Transforming Growth Factor Beta-1 (TGFB1) Antibody

Sign In for Pricing
View Details
TPPP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2429708 1.0 µg DNA

TPPP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rat Pmm2 Pre-designed siRNA Set B
SI210730B 1 Each

Rat Pmm2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Olfactory receptor 10AG1 Rabbit Polyclonal Antibody
E28PT3246 100 µL

Olfactory receptor 10AG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details