Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 1/IL-29, Human (His)

IFN-lambda 1/IL-29 protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a crucial role in antiviral host defense, especially in epithelial tissues. Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 1/IL-29 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 1/IL-29 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-1-il-29-protein-human-his.html

Purity

95.0

Smiles

MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Molecular Formula

282618 (Gene_ID) Q8IU54 (P23-T200) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-100 1x 100 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (2H12), CF568 conjugate, 0.1mg/mL
BNC680751-100 1x 100 µL

Bcl-x (2H12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF647 conjugate, 0.1mg/mL
BNC471041-100 1x 100 µL

TRIM29 (TRIM29/1041), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF740 conjugate, 0.1mg/mL
BNC740940-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF740 conjugate, 0.1mg/mL
BNC741922-500 1x 500 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details