Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL4, Human (HEK293, His)

The INSL4 protein plays a potentially critical role in the regulation of trophoblast development and bone formation. The specific mechanism of trophoblast development deserves further study. INSL4 Protein, Human (HEK293, His) is the recombinant human-derived INSL4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

INSL4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl4-protein-human-hek-293-his.html

Purity

90.0

Smiles

AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT

Molecular Formula

3641 (Gene_ID) Q14641 (A26-T139) (Accession)

Molecular Weight

Approximately 9.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL
BNC881798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), CF647 conjugate, 0.1mg/mL
BNC472953-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2953), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF568 conjugate, 0.1mg/mL
BNC682149-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details