Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALK-1, Cynomolgus (HEK293, His)

ALK-1, also known as ACVRL1, is a type I receptor for TGF-β superfamily with 2 ligands, BMP9 and BMP10. ALK-1 is predominantly expressed in endothelial cells and plays a critical role in regulating developmental and pathological angiogenesis[1][2]. ALK-1 Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 118 amino acids (D22-Q118) .

Product Specifications

Product Name Alternative

ALK-1 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alk-1-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

DPVKPSRGPLVTCTCESPHCRGPTCQGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQ

Molecular Formula

102143641 (Gene_ID) XP_005570958 (D22-Q118) (Accession)

Molecular Weight

Approximately 21-25 kDa due to the glycosylation.

References & Citations

[1]S P Oh, et al. Activin receptor-like kinase 1 modulates transforming growth factor-beta 1 signaling in the regulation of angiogenesis. Proc Natl Acad Sci U S A. 2000 Mar 14;97 (6) :2626-31.|[2]Dianyuan Zhao, et al. ALK1 signaling is required for the homeostasis of Kupffer cells and prevention of bacterial infection. J Clin Invest. 2022 Feb 1;132 (3) :e150489.|[3]Dianne Mitchell, et al. ALK1-Fc inhibits multiple mediators of angiogenesis and suppresses tumor growth. Mol Cancer Ther. 2010 Feb;9 (2) :379-88.|[4]Kerstin Wöltje, et al. Serum induces transcription of Hey1 and Hey2 genes by Alk1 but not Notch signaling in endothelial cells. PLoS One. 2015 Mar 23;10 (3) :e0120547.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXLD1 Recombinant Protein Antigen
NBP2-31653PEP 0.1 mL

OXLD1 Recombinant Protein Antigen

Sign In for Pricing
View Details
GCF Antibody
MBS8588274-01 0.1 mg

GCF Antibody

Sign In for Pricing
View Details
GCF Antibody
MBS8588274-02 0.1 mL (AF405L)

GCF Antibody

Sign In for Pricing
View Details
GCF Antibody
MBS8588274-03 0.1 mL (AF405S)

GCF Antibody

Sign In for Pricing
View Details
GCF Antibody
MBS8588274-04 0.1 mL (AF610)

GCF Antibody

Sign In for Pricing
View Details
GCF Antibody
MBS8588274-05 0.1 mL (AF635)

GCF Antibody

Sign In for Pricing
View Details