Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MIG7 (MIG7)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human MIG7 protein

Gene Name

MIG7

UniProt

Q1AHR6

Expression Region

1-207aa

Organism

Homo sapiens (Human)

Target Sequence

MAASRCSGLSEMTLLGSQAVSGLSSPLKSPCQVWNSPSPVCVCVCVCVCVCTRVHMRACSAGSAYLKQMKFCRMAASLDKVKKTDRGERGSCVSTTKRQASLSQRDIPSNNMKLATFPSDVNVESVAASLFFTVMKLGATQLEWNTKTPLGNTSSGFESQLYHSPAIDSEQDLSEVISSQSVETRLTSKVLKVEPESMNAKVFTFKL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.3 kDa

References & Citations

"MIG-7 controls COX-2/PGE2-mediated lung cancer metastasis." Ho M.Y., Liang S.M., Hung S.W., Liang C.M. Cancer Res. 73:439-449 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCLL1 Protein Vector (Mouse) (pPM-C-His)
PV189181 500 ng

HMGCLL1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Probable ascorbate-specific transmembrane electron transporter 1 (Os02g0642300, LOC_Os02g42890)
orb2911980-01 20 µg

Recombinant Oryza sativa subsp. japonica Probable ascorbate-specific transmembrane electron transporter 1 (Os02g0642300, LOC_Os02g42890)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Probable ascorbate-specific transmembrane electron transporter 1 (Os02g0642300, LOC_Os02g42890)
orb2911980-02 100 µg

Recombinant Oryza sativa subsp. japonica Probable ascorbate-specific transmembrane electron transporter 1 (Os02g0642300, LOC_Os02g42890)

Sign In for Pricing
View Details
Human Fallopian Tube Tissue Lysate
MBS8411365-01 0.1 mg

Human Fallopian Tube Tissue Lysate

Sign In for Pricing
View Details
Human Fallopian Tube Tissue Lysate
MBS8411365-02 5x 0.1 mg

Human Fallopian Tube Tissue Lysate

Sign In for Pricing
View Details
4-Ethyl-2- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline
OR1085745 250 mg

4-Ethyl-2- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline

Sign In for Pricing
View Details