Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPZL1, Human (HEK293, His)

MPZL1 protein is a cell surface receptor that participates in signal transduction by recruiting PTPN11/SHP-2 to the cell membrane. MPZL1 Protein, Human (HEK293, His) is the recombinant human-derived MPZL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MPZL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mpzl1-protein-human-hek-293-his.html

Purity

95.0

Smiles

SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPV

Molecular Formula

9019 (Gene_ID) O95297 (S36-V162) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAR-MT
GW1738-5mg 5 mg

DAR-MT

Sign In for Pricing
View Details
FosB AAV Vector (Mouse) (CMV)
20746104 1 µg

FosB AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Ldc1 Mouse Gene Knockout Kit (CRISPR)
KN507013 1 Kit

Ldc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZFP36 Antibody
orb1243361 100 µL

ZFP36 Antibody

Sign In for Pricing
View Details
Anti-Oxytocin Receptor Rabbit Monoclonal Antibody
M01566 100 µL/Vial

Anti-Oxytocin Receptor Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 14 (MMP14) ELISA Kit
MBS2704128-01 24 Strip Well

Mouse Matrix Metalloproteinase 14 (MMP14) ELISA Kit

Sign In for Pricing
View Details