Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMP2, Human (His)

The PMP2 protein may act as a lipid transporter within Schwann cells, suggesting a role in lipid transport and cellular homeostasis. PMP2 may also bind cholesterol, suggesting involvement in cholesterol-related pathways. PMP2 Protein, Human (His) is the recombinant human-derived PMP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PMP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pmp2-protein-human-his.html

Purity

95.0

Smiles

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

Molecular Formula

5375 (Gene_ID) P02689 (M1-V132) (Accession)

Molecular Weight

14-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp140 Nuclear Body Protein (SP140) Magnetic Luminex Assay Kit
LKU601352 96 Tests

Sp140 Nuclear Body Protein (SP140) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
α-synuclein (2B2D1) PE
sc-53955 PE 200 µg/mL

α-synuclein (2B2D1) PE

Sign In for Pricing
View Details
GRPR discontinued
318081 100 µL

GRPR discontinued

Sign In for Pricing
View Details
Relaxin (RLN) Recombinant, Mouse
156606-01 10 µg

Relaxin (RLN) Recombinant, Mouse

Sign In for Pricing
View Details
Relaxin (RLN) Recombinant, Mouse
156606-02 50 µg

Relaxin (RLN) Recombinant, Mouse

Sign In for Pricing
View Details
Relaxin (RLN) Recombinant, Mouse
156606-03 200 µg

Relaxin (RLN) Recombinant, Mouse

Sign In for Pricing
View Details